General Information

  • ID:  hor001973
  • Uniprot ID:  P01282
  • Protein name:  Intestinal peptide PHM-27
  • Gene name:  VIP
  • Organism:  Homo sapiens (Human)
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with VIP include Vipoma and Vasomotor Rhinitis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001938 positive regulation of endothelial cell proliferation; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007589 body fluid secretion; GO:0007611 learning or memory; GO:0008284 positive regulation of cell population proliferation; GO:0032812 positive regulation of epinephrine secretion; GO:0032879 regulation of localization; GO:0032880 regulation of protein localization; GO:0043066 negative regulation of apoptotic process; GO:0043267 negative regulation of potassium ion transport; GO:0045732 positive regulation of protein catabolic process; GO:0048242 epinephrine secretion; GO:0048255 mRNA stabilization; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0060406 positive regulation of penile erection; GO:0070459 prolactin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0043005 neuron projection

Sequence Information

  • Sequence:  HADGVFTSDFSKLLGQLSAKKYLESLM
  • Length:  27
  • Propeptide:  MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
  • Signal peptide:  MDTRNKAQLLVLLTLLSVLF
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause vasodilation;is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  VIPR1, VIPR2
  • Target Unid:  P32241, P41587
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 6.5 minutes; /390 seconds ( PubMed ID: 2162275 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01282-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001973_AF2.pdbhor001973_ESM.pdb

Physical Information

Mass: 345038 Formula: C135H213N33O41S
Absent amino acids: CINPRW Common amino acids: L
pI: 7.54 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -2.22 Boman Index: -2496
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 90.37
Instability Index: 768.15 Extinction Coefficient cystines: 1490
Absorbance 280nm: 57.31

Literature

  • PubMed ID:  2162275
  • Title:  NA